GHS-R1a comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Ipamorelin is a synthetic pentapeptide first described in the 1990s by researchers at Novo Nordisk during a program to develop selective growth hormone secretagogues. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, incorporating two non-natural residues, alpha-aminoisobutyric acid and D-2-naphthylalanine. The C-terminus is amidated, and the material is supplied as a white lyophilized powder. The molecular formula is C38H49N9O5 and the monoisotopic mass is approximately 711.85 daltons. The short chain and modified residues give it greater resistance to enzymatic degradation than many larger peptide hormones.
At the molecular level, ipamorelin acts as an agonist at the growth hormone secretagogue receptor type 1a, the same G protein-coupled receptor that binds ghrelin. Receptor activation couples to Gq/11 signaling, raising intracellular calcium through inositol trisphosphate and diacylglycerol, which in turn promotes exocytosis of growth hormone from pituitary somatotroph cells. Ipamorelin binds this receptor with high affinity and shows weak activity at other secretagogue-related targets in vitro. Its action requires the intact receptor and is not reversed by growth hormone-releasing hormone antagonists.
Compared with earlier growth hormone secretagogues such as GHRP-6 and hexarelin, ipamorelin has been reported to produce less stimulation of adrenocorticotropic hormone, cortisol, and prolactin in animal and early human studies. This selectivity is usually attributed to differences in receptor subtype interactions and to the tissue distribution of the receptor. Effects on appetite appear weaker than those of ghrelin itself, although the supporting evidence base is small. Whether these differences produce a distinct clinical profile remains an open question, since controlled human trials are limited.
Purity assessment for this peptide relies mainly on reversed-phase high-performance liquid chromatography. A C18 column with a water-acetonitrile gradient containing trifluoroacetic acid separates the target from truncated sequences and oxidation products. Detection near 214 nm exploits the amide backbone, while the aromatic side chains allow additional monitoring close to 280 nm. Reported purity values depend on the method, so a certificate of analysis carries weight only when gradient, column and integration parameters are given.
Mass spectrometry confirms identity and reveals structural deviations that chromatography alone can miss. Positive-mode electrospray ionisation generally yields multiply charged ions whose deconvoluted mass is checked against the theoretical value. Amino acid analysis, and enzymatic digestion with subsequent fragment mapping, provide independent confirmation of sequence and of the terminal amide. Analysts take care to separate the target from deletion sequences, which may differ by one residue and therefore by only a small mass increment.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H49N9O5 | Pentapeptide with amidated C-terminus |
| Molecular weight | 711.85 g/mol | Monoisotopic mass |
| Primary receptor | GHS-R1a | Ghrelin receptor, Gq/11 coupled |
| Peptide class | Synthetic pentapeptide | Contains two non-natural residues |
| Reported selectivity | Lower cortisol and prolactin effect | Observed in animal and early human work |
Long-term storage of the dry powder is typically at minus twenty degrees Celsius or lower, protected from light and moisture. Solutions are commonly kept frozen and thawed only once, because repeated freeze-thaw cycles can promote aggregation and loss of measurable peptide content. Buffers near neutral pH are preferred over strongly acidic or strongly basic conditions. Shipping at ambient temperature is acceptable for short periods when the powder remains sealed and desiccated.
Identity and purity are assessed by complementary methods rather than a single test. Reversed-phase high-performance liquid chromatography separates the peptide from related impurities and reports a percentage purity. Mass spectrometry, most often with electrospray ionization, confirms the expected molecular mass and detects sequence-related variants. Amino acid analysis can verify composition, while water content and residual counterion measurements support the mass balance of a batch. Stability studies under accelerated conditions are used to estimate shelf life, though such estimates carry uncertainty for long-term storage.
Ipamorelin is a synthetic pentapeptide classified as a growth hormone secretagogue. Its sequence, Aib-His-D-2-Nal-D-Phe-Lys-NH2, combines three non-proteinogenic residues with a C-terminal amide. The N-terminal aminoisobutyric acid unit and the two aromatic D-amino acids distinguish it from peptides assembled only from standard L-amino acids. Its formula is C38H49N9O5, corresponding to an average mass near 711.9 Da. At neutral pH the molecule carries a net positive charge, a property that shapes its behaviour in chromatographic and electrophoretic systems.
The compound was developed at Novo Nordisk during the 1990s as part of a programme seeking secretagogues with improved selectivity. It was described in the peer-reviewed literature in 1998 alongside related pentapeptides from the same series. Investigators advanced it because it raised growth hormone output in animal models while leaving other pituitary hormones comparatively unaffected. The development code NNC 26-0161 appears in earlier reports, and ipamorelin later became the common designation in published work.
Selectivity is the property most often attached to this peptide. Published animal and early human studies record increases in growth hormone release after administration, with adrenocorticotropic hormone and cortisol responses remaining small by comparison. Effects on appetite-related pathways also appear weaker than those reported for several earlier secretagogues. Reviews that compare members of the growth hormone secretagogue family cite these findings frequently, though the receptor-level explanation for the selectivity continues to be debated rather than settled.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class of compounds. Researchers at a pharmaceutical company first described it in the 1990s while screening small peptides for growth hormone releasing activity. Its chain contains five amino acid residues, two of which are non-natural building blocks, including 2-aminoisobutyric acid and a naphthylalanine derivative. The molecule was designed to act at the ghrelin receptor while avoiding several effects observed with earlier secretagogues.
At the cellular level, ipamorelin binds the growth hormone secretagogue receptor, also called the ghrelin receptor. Activation of this receptor on pituitary somatotroph cells triggers a signaling cascade that leads to release of growth hormone into circulation. Because release follows a pulsatile pattern, studies often report peak concentration and total area under the curve rather than a single time point. Selectivity for this receptor is the property most frequently discussed in comparative work.
Compared with older secretagogues such as hexarelin or GHRP-6, ipamorelin shows weaker stimulation of cortisol, prolactin, and appetite in the animal models used for early characterization. Whether that selectivity is preserved across longer human exposures remains an open question, because published clinical data are limited in size and duration. Reported effects on food intake are generally described as modest. The compound is therefore treated in the literature as a relatively selective research tool rather than a fully characterized therapeutic agent.
The pia mater (Latin: tender mother) is a very delicate membrane. It is the meningeal envelope that firmly adheres to the surfaces of the brain and spinal cord, following all of the brain's contours (gyri and sulci). It is a very thin sheet of connective tissue that interfaces with the glial limitans superficialis but lacks capillaries itself.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
== External links == Amino acid metabolism Chapter on Amino acid catabolism in Biochemistry by Jeremy Berg, John Tymoczko, Lubert Stryer. Fourth ed. by Lubert Stryer. ISBN 0-7167-4955-6 Accessed 2007-03-17 Amino acid metabolism
Sources: en.wikipedia.org
Control is a standard against which experimental observations may be evaluated. In clinical trials, one group of participants is given an experimental drug, while another group (i.e., the control group) is given either a standard treatment for the disease or a placebo. (NLM) Coordinating Committee
=== Flowering === Flowering is triggered by day length, often beginning once days become shorter than 12.8 hours. This trait is highly variable however, with different varieties reacting differently to changing day length. Soybeans form inconspicuous, self-fertile flowers which are borne in the axil of the leaf and are white, pink or purple. Though they do not require pollination, they are attractive to bees, because they produce nectar that is high in sugar content. Depending on the soybean variety, node growth may cease once flowering begins. Strains that continue nodal development after flowering are termed "indeterminates" and are best suited to climates with longer growing seasons. Often soybeans drop their leaves before the seeds are fully mature.
aqua regia A liquid mixture of nitric acid (HNO3) and hydrochloric acid (HCl), optimally in a molar ratio of 1:3, so named by historical alchemists because it is capable of dissolving the noble metals gold and platinum.
Founder and Leader, The Country Playgroup. For services to Early Years Education in County Antrim. Sara Patricia Jane Walker. Volunteer, Teddington Hockey Club. For services to Hockey and Masters Hockey, and to the community in the London Borough of Richmond upon Thames. Mary Lamorna Wallis. For services to the NHS and to the community in Bloomsbury, London Borough of Camden. Penelope Jean Walters. For services to the community in Byker, Newcastle upon Tyne, particularly during Covid-19. Russell Mark Walters. Director, Cardiff Cymru and Careline Co-ordinator, Care for the Family. For voluntary service in Wales. Helen Elizabeth Walton. Policy Adviser, Rochdale Council. For services to Children in Care and Children in Poverty. Leslie John Want. For services to the community in Sketty and Swansea. Sharon Ann Warboys. For services to the community in Dunstable, Bedfordshire, particularly during Covid-19. Vivienne Ward. Lately Office Manager, Conservative Campaign Headquarters Wales and Secretary, Welsh Board of Management, Conservative Party. For Political Service. Adam Samuel Watson. Dairy Farmer, Coleraine. For services to Mental Health in the Farming Community in Northern Ireland. Hayley Marie Watson. For services to the community in Exmouth, Devon, particularly during Covid-19. The Reverend Roy Morgan Watson. For services to the community in Blaina, Blaeneau Gwent. William Joseph Watson. Director, Great North Big Band Jazz Festival. For services to Music. Timothy Edward Way. For services to the community in Westcott, Surrey. Rosemary Dale Webb.
Sources: en.wikipedia.org
It is a synthetic pentapeptide belonging to the growth hormone secretagogue family. Its principal characterized target is the ghrelin receptor, also called GHS-R1a. The molecule contains non-natural amino acids and an amidated C-terminus.
Both act at the same G protein-coupled receptor, but ipamorelin is a short synthetic peptide with modified residues rather than the natural 28-amino-acid hormone. Reports describe weaker effects on appetite and on cortisol or prolactin release than those seen with ghrelin. Its resistance to enzymatic breakdown also differs from that of the natural ligand.
Receptor binding and downstream calcium signaling are well characterized in cell-based systems. Effects measured in whole organisms are less consistent across studies and species. The extent to which selective receptor behavior drives the observed hormonal profile is still debated.
Results are most often expressed as a percentage of total peak area from a reversed-phase separation. That figure reflects the detection wavelength, gradient and integration choices used by the laboratory. Two valid certificates can therefore quote different values for the same material without either being incorrect.